PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003352.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 582aa    MW: 65263.9 Da    PI: 5.5027
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003352.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM148.24.3e-46482011128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk............................kvkaeekew 58 
                              + pGfrF+Ptdeel+++yLkkk+e+ +  + evi+ev+i ++ePwdLp                             +v ++++ew
  Itr_sc003352.1_g00004.1  48 MFPGFRFSPTDEELISYYLKKKLEAFDECV-EVIPEVEIWRHEPWDLPDnlfefvcsinklgcmdassaisyevitkSVVQSDNEW 132
                              579**********************99666.99***************5599*************9999999987765555889** PP

                      NAM  59 yfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +fFs+r +ky++g++++rat+sgyWkatgk+++v+s +++++g+k+tLvf++grapkg++t+W+mhey +
  Itr_sc003352.1_g00004.1 133 FFFSPRGRKYPNGSQSRRATESGYWKATGKERNVKS-GSKVIGTKRTLVFHTGRAPKGQRTQWIMHEYCI 201
                              ************************************.9******************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-484596IPR003441NAC domain
PROSITE profilePS5100549.9748218IPR003441NAC domain
PfamPF023652.0E-2550200IPR003441NAC domain
SuperFamilySSF1019412.09E-48121217IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MADEGDISLS RQNKEDNSME RISGRNNNNN NDETNGKIEI SLATASSMFP GFRFSPTDEE  60
LISYYLKKKL EAFDECVEVI PEVEIWRHEP WDLPDNLFEF VCSINKLGCM DASSAISYEV  120
ITKSVVQSDN EWFFFSPRGR KYPNGSQSRR ATESGYWKAT GKERNVKSGS KVIGTKRTLV  180
FHTGRAPKGQ RTQWIMHEYC IGEKEYQDSM VVCRLRKNNE FHLNDTLGNS RNQSIVNTSN  240
NAFSELEYTG SLGGLHAGDS CSKECSSSLN SHSVEQIDPG VDCDLVNEIS QCGSSSHQKD  300
DGNAEDWFAD IMRDDIVKLD DTSLNTSLDV LPVSNKNPVP DIKPKQPAQG LKPHVLPFQG  360
TANRRLRLRR DRVTFFETSW IAQLFSQHGA KVLIADTRDH ESQSICKDLG PGNAFLMSQA  420
SQGKGITFPS KSYVEGKLHY LGNVIFPYED EPNVGMLALE CHIPFVMLYN LNQTPPKGVD  480
LMTEDVAKAV LYLASTAVVL KGNCSCTEQR SFIRSTQLQN PFNTTAESVQ HNCSIFSTQL  540
QFQMDDTASV PRNCNFLSTQ LQYPFNTTVV SVQHNCSINY DP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D6e-394421716167NAC domain-containing protein 19
3swp_C6e-394421716167NAC domain-containing protein 19
3swp_B6e-394421716167NAC domain-containing protein 19
3swp_A6e-394421716167NAC domain-containing protein 19
3swm_D6e-394421716167NAC domain-containing protein 19
3swm_C6e-394421716167NAC domain-containing protein 19
3swm_B6e-394421716167NAC domain-containing protein 19
3swm_A6e-394421716167NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1363370RRLRLRRD
2366371RLRRDR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016577960.11e-141PREDICTED: NAC domain-containing protein 40-like
TrEMBLK4C9D51e-140K4C9D5_SOLLC; Uncharacterized protein
STRINGSolyc06g074170.2.11e-140(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.12e-79NAC domain containing protein 60